View larger
Human HBEGF (Q99075, 63 a.a. - 148 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P7275
New product
HBEGF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | HBEGF |
| Gene Alias | DTR|DTS|DTSF|HEGFL |
| Gene Description | heparin-binding EGF-like growth factor |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAP SCICHPGYHGERCHGLSL |
| Form | Lyophilized |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
| Gene ID | 1839 |
More info
Human HBEGF (Q99075, 63 a.a. - 148 a.a.) partial recombinant protein expressed in Escherichia coli.