AB-P7164
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 20 ug |
Gene Name | TNFRSF17 |
Gene Alias | BCM|BCMA|CD269 |
Gene Description | tumor necrosis factor receptor superfamily, member 17 |
Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
Form | Lyophilized |
Storage Buffer | Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml |
Gene ID | 608 |