PLG (Human) Recombinant Protein View larger

Human PLG (P00747, 98 a.a. - 356 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

AB-P7163

New product

PLG (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.


Data sheet

Size 10 ug
Gene Name PLG
Gene Alias DKFZp779M0222
Gene Description plasminogen
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSC
Form Lyophilized
Storage Buffer Lyophilized from sterile distilled Water up to 0.1 - 1.0 mg/ml
Gene ID 5340

More info

Human PLG (P00747, 98 a.a. - 356 a.a.) partial recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human PLG (P00747, 98 a.a. - 356 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.

Human PLG (P00747, 98 a.a. - 356 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.