View larger
Mouse VGFA (Q00731-2, 27 a.a. - 190 a.a.) partial recombinant protein expressed in <i>Pichia pastoris</i>.
AB-P7146
New product
VEGFA (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 27 pontos de fidelização. Seu carrinho totalizará 27 pontos de fidelização que podem ser convertidos num vale de desconto de 108.00EUR.
Data sheet
| Size | 1 mg |
| Gene Name | Vegfa |
| Gene Alias | Vegf|Vegf-a|Vegf120|Vegf164|Vegf188|Vpf |
| Gene Description | vascular endothelial growth factor A |
| Storage Conditions | Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKN |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from sterile distilled Water up to 100 ug/ml |
| Gene ID | 22339 |
More info
Mouse VGFA (Q00731-2, 27 a.a. - 190 a.a.) partial recombinant protein expressed in Pichia pastoris.