IL10 (Human) Recombinant Protein View larger

Human IL10 (P22301 19 a.a. - 178 a.a.) partial recombinant protein expressed in CHO cell.

AB-P7102

New product

IL10 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 10 ug
Gene Name IL10
Gene Alias CSIF|IL-10|IL10A|MGC126450|MGC126451|TGIF
Gene Description interleukin 10
Storage Conditions Store at 4ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Form Lyophilized
Storage Buffer Lyophilized from PBS up to 100 ug/ml
Gene ID 3586

More info

Human IL10 (P22301 19 a.a. - 178 a.a.) partial recombinant protein expressed in CHO cell.

Enviar uma mensagem

Human IL10 (P22301 19 a.a. - 178 a.a.) partial recombinant protein expressed in CHO cell.

Human IL10 (P22301 19 a.a. - 178 a.a.) partial recombinant protein expressed in CHO cell.