View larger
HCoV-HKU1 N (Q5MQC6, 1 a.a.- 441 a.a.) full-length recombinant protein with His tag at C-terminal expressed in <i>Escherichia co
AB-P6654
New product
N (HCoV-HKU1) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 ug |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>Aftern reconstitution with deionized water and concentration not less than 100 ug/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved, store at -20ºC or -80ºC.<br>Aliquot to avoid r |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MSYTPGHYAGSRSSSGNRSGILKKTSWADQSERNYQTFNRGRKTQPKFTVSTQPQGNTIPHYSWFSGITQFQKGRDFKFSDGQGVPIAFGVPPSEAKGYWYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPGSRSQSRGPNNRSLSRSNSNFRHSDSIVKPDMADEIANLVLAKLGKDSKPQQVTKQ |
| Form | Lyophilized |
| Recomended Dilution | SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Viruses |
| Quality control testing | SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from PBS, pH 7.4. |
More info
HCoV-HKU1 N (Q5MQC6, 1 a.a.- 441 a.a.) full-length recombinant protein with His tag at C-terminal expressed in Escherichia coli.