Csf1 (Rat) Recombinant Protein View larger

Rat Csf1 (Q8JZQ0) recombinant protein expressed in <i>E.Coli</i>.

AB-P6455

New product

Csf1 (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name Csf1
Gene Alias -
Gene Description colony stimulating factor 1 (macrophage)
Storage Conditions Stored at -20ºC to-80ºC for 12 month.<br>After reconstitution with sterile water at 0.1 mg/mL, store at -20ºC to -80ºC for 3 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP
Form Lyophilized
Quality control testing Reducing and Non-Reducing SDS PAGE
Storage Buffer Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5.
Gene ID 78965

More info

Rat Csf1 (Q8JZQ0) recombinant protein expressed in E.Coli.

Enviar uma mensagem

Rat Csf1 (Q8JZQ0) recombinant protein expressed in <i>E.Coli</i>.

Rat Csf1 (Q8JZQ0) recombinant protein expressed in <i>E.Coli</i>.