FGF16 (Human) Recombinant Protein View larger

Human FGF16 (O43320) recombinant protein expressed in <i>E. Coli</i>.

AB-P6354

New product

FGF16 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.


Data sheet

Size 100 ug
Gene Name FGF16
Gene Alias -
Gene Description fibroblast growth factor 16
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB
Immunogen Prot. Seq AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 8823

More info

Human FGF16 (O43320) recombinant protein expressed in E. Coli.

Enviar uma mensagem

Human FGF16 (O43320) recombinant protein expressed in <i>E. Coli</i>.

Human FGF16 (O43320) recombinant protein expressed in <i>E. Coli</i>.