DLL1 (Human) Recombinant Protein View larger

Human DLL1 (O00548) recombinant protein expressed in CHO cells.

AB-P6349

New product

DLL1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100 ug
Gene Name DLL1
Gene Alias DELTA1|DL1|Delta
Gene Description delta-like 1 (Drosophila)
Storage Conditions Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,Func
Immunogen Prot. Seq SGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNC
Form Lyophilized
Storage Buffer Lyophilized from PBS, pH 7.2.
Gene ID 28514

More info

Human DLL1 (O00548) recombinant protein expressed in CHO cells.

Enviar uma mensagem

Human DLL1 (O00548) recombinant protein expressed in CHO cells.

Human DLL1 (O00548) recombinant protein expressed in CHO cells.