View larger
Human INHBB (P09529) recombinant protein expressed in CHO cells.
AB-P6324
New product
INHBB (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 9 pontos de fidelização. Seu carrinho totalizará 9 pontos de fidelização que podem ser convertidos num vale de desconto de 36.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | INHBB |
| Gene Alias | MGC157939 |
| Gene Description | inhibin, beta B |
| Storage Conditions | Stored at -20ºC to-80ºC.<br>After reconstitution with sterile water not less than 0.1 mg/mL, store at -20ºC to -80ºC for 6 months, store at 4ºC for 1 month.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB |
| Immunogen Prot. Seq | GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA |
| Form | Lyophilized |
| Storage Buffer | Lyophilized from PBS, pH 7.2. |
| Gene ID | 3625 |
More info
Human INHBB (P09529) recombinant protein expressed in CHO cells.