HBA2 (Human) Recombinant Protein View larger

Human HBA2 (NP_000508, 1 a.a. - 142 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P5858

New product

HBA2 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name HBA2
Gene Alias -
Gene Description hemoglobin, alpha 2
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol, 2 M urea, 2 mM DTT).
Gene ID 3040

More info

Human HBA2 (NP_000508, 1 a.a. - 142 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human HBA2 (NP_000508, 1 a.a. - 142 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human HBA2 (NP_000508, 1 a.a. - 142 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.