View larger
Human LDOC1L (NP_115663, 1 a.a. - 239 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P5852
New product
LDOC1L (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | LDOC1L |
| Gene Alias | DKFZp761O17121|Mar6|Mart6|dJ1033E15.2 |
| Gene Description | leucine zipper, down-regulated in cancer 1-like |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMVQPQTSKAESPALAASPNAQMDDVIDTLTSLRLTNSALRREASTLRAEKANLTNMLESVMAELTLLRTRARIPGALQITPPISSITSNGTRPMTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQASRFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLRNNYQGFLAELRRTYKSPLRHARRAQIRKTSASNRAVRERQMLCRQLASAGTGPCPVHPASNGTSPAPA |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed. |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.1 M NaCl, 1 mM EDTA, pH 8.0 (40% glycerol, 2 mM DTT, 0.1 mM PMSF). |
| Gene ID | 84247 |
More info
Human LDOC1L (NP_115663, 1 a.a. - 239 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.