View larger
Human IL12B (NP_002178, 23 a.a. - 328 a.a.) partial recombinant protein with His tag expressed in Hi-5 cells.
AB-P5393
New product
IL12B (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | IL12B |
| Gene Alias | CLMF|CLMF2|IL-12B|NKSF|NKSF2 |
| Gene Description | interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | ADPIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFC |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 100 mM NaCl, pH 8.0 (2 mM DTT, 20% glycerol, 0.1 mM PMSF). |
| Gene ID | 3593 |
More info
Human IL12B (NP_002178, 23 a.a. - 328 a.a.) partial recombinant protein with His tag expressed in Hi-5 cells.