View larger
Human PAK2 kinase domain (Q13177, 227 a.a. - 524 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P5383
New product
PAK2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 7 pontos de fidelização. Seu carrinho totalizará 7 pontos de fidelização que podem ser convertidos num vale de desconto de 28.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | PAK2 |
| Gene Alias | PAK65|PAKgamma |
| Gene Description | p21 protein (Cdc42/Rac)-activated kinase 2 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/ml |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | <u><b>GPHM</b></u>TDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRS<u><b>T</u></b>MVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLR |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 6 ug protein in SDS-PAGE |
| Storage Buffer | In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT. |
| Gene ID | 5062 |
More info
Human PAK2 kinase domain (Q13177, 227 a.a. - 524 a.a.) partial recombinant protein expressed in Escherichia coli.