View larger
NS3 (HCV) (NP_671491, 1225 a.a. - 1456 a.a.) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P4911
New product
NS3 (HCV) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | HCVgp1 |
| Gene Alias | - |
| Gene Description | polyprotein |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTG |
| Form | Liquid |
| Antigen species Target species | Viruses |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol, 1 mM DTT). |
| Gene ID | 951475 |
More info
NS3 (HCV) (NP_671491, 1225 a.a. - 1456 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.