HBsAg (ayw) Recombinant Protein View larger

HBsAg (ayw) (CAA05872) full-length Recombinant protein expressed in yeast.

AB-P4875

New product

HBsAg (ayw) Recombinant Protein

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 50 ug
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
Form Liquid
Antigen species Target species Viruses
Storage Buffer In 50 mM phosphate buffer, 200 mM NaCl, pH7.2

More info

HBsAg (ayw) (CAA05872) full-length Recombinant protein expressed in yeast.

Enviar uma mensagem

HBsAg (ayw) (CAA05872) full-length Recombinant protein expressed in yeast.

HBsAg (ayw) (CAA05872) full-length Recombinant protein expressed in yeast.