Il17a (Rat) Recombinant Protein View larger

Rat Il17a recombinant protein expressed in <i>Escherichia coli</i>.

AB-P4843

New product

Il17a (Rat) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25 ug
Gene Name Il17a
Gene Alias -
Gene Description interleukin 17A
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer Lyophilized from 10 mM sodium citrate, pH 3.0
Gene ID 301289

More info

Rat Il17a recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Rat Il17a recombinant protein expressed in <i>Escherichia coli</i>.

Rat Il17a recombinant protein expressed in <i>Escherichia coli</i>.