View larger
Human STK16 (NP_001008910.1, 1 a.a. - 305 a.a.) full-length recombinant protein with GST-His tag with a Thrombin cleavage site a
AB-P4788
New product
STK16 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 22 pontos de fidelização. Seu carrinho totalizará 22 pontos de fidelização que podem ser convertidos num vale de desconto de 88.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | STK16 |
| Gene Alias | FLJ39635|KRCT|MPSK|PKL12|TSF1 |
| Gene Description | serine/threonine kinase 16 |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing |
| Concentration | 1.020 ug/uL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPMGHHHHHHGRRRASVAAGILVPRGSPGLDGIYAR |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 2 ug/lane SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 50 mM Tris-HCl, 100 mM NaCl, pH 8.0 (5 mM DTT, 15 mM reduced glutathione, 20% glycerol). |
| Gene ID | 8576 |
More info
Human STK16 (NP_001008910.1, 1 a.a. - 305 a.a.) full-length recombinant protein with GST-His tag with a Thrombin cleavage site at N-terminal expressed in Sf9 insect cells.