View larger
Human IKBKB (NM_001556, 1 a.a. - 756 a.a.) full-length recombinant protein with GST-His tag expressed in Sf9 cells.
AB-P4703
New product
IKBKB (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 22 pontos de fidelização. Seu carrinho totalizará 22 pontos de fidelização que podem ser convertidos num vale de desconto de 88.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | IKBKB |
| Gene Alias | FLJ40509|IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB |
| Gene Description | inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing |
| Concentration | 0.695 ug/uL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKF |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 2 ug/lane SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 50 mM Hepes, 100 mM NaCl, pH 7.5. (5 mM DTT, 20% glycerol) |
| Gene ID | 3551 |
More info
Human IKBKB (NM_001556, 1 a.a. - 756 a.a.) full-length recombinant protein with GST-His tag expressed in Sf9 cells.