View larger
Human ALK (NP_004295.2, 1066 a.a. - 1437 a.a.) partial recombinant protein with GST-His tag expressed in Sf9 cells.
AB-P4644
New product
ALK (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 22 pontos de fidelização. Seu carrinho totalizará 22 pontos de fidelização que podem ser convertidos num vale de desconto de 88.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | ALK |
| Gene Alias | CD246|Ki-1|TFG/ALK |
| Gene Description | anaplastic lymphoma receptor tyrosine kinase |
| Storage Conditions | Store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | LQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLW |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 2 ug/lane SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 50 mM Hepes, 100 mM NaCl, pH 7.5. (5 mM DTT, 15 mM reduced glutathione, 20% glycerol) |
| Gene ID | 238 |
More info
Human ALK (NP_004295.2, 1066 a.a. - 1437 a.a.) partial recombinant protein with GST-His tag expressed in Sf9 cells.