Shh (Mouse) Recombinant Protein View larger

Mouse Shh (Q15465) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P4621

New product

Shh (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25 ug
Gene Name Shh
Gene Alias 9530036O11Rik|Dsh|Hhg1|Hx|Hxl3|M100081
Gene Description sonic hedgehog
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized with 10 mM Na<sub>2</sub>PO<sub>4</sub>, pH 7.5.
Gene ID 20423

More info

Mouse Shh (Q15465) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Mouse Shh (Q15465) recombinant protein expressed in <i>Escherichia coli</i>.

Mouse Shh (Q15465) recombinant protein expressed in <i>Escherichia coli</i>.