CXCL3 (Human) Recombinant Protein View larger

Human CXCL3 (P19876) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P4570

New product

CXCL3 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 10 ug
Gene Name CXCL3
Gene Alias CINC-2b|GRO3|GROg|MIP-2b|MIP2B|SCYB3
Gene Description chemokine (C-X-C motif) ligand 3
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized with 10 mM Na<sub>2</sub>PO<sub>4</sub>, pH 7.5.
Gene ID 2921

More info

Human CXCL3 (P19876) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human CXCL3 (P19876) recombinant protein expressed in <i>Escherichia coli</i>.

Human CXCL3 (P19876) recombinant protein expressed in <i>Escherichia coli</i>.