View larger
Human GPX2 (NP_002074, 1 a.a. - 190 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P4538
New product
GPX2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | GPX2 |
| Gene Alias | GI-GPx|GPRP|GSHPX-GI|GSHPx-2 |
| Gene Description | glutathione peroxidase 2 (gastrointestinal) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLCGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.15 M NaCl, pH7.5 (40% glycerol, 1 mM DTT). |
| Gene ID | 2877 |
More info
Human GPX2 (NP_002074, 1 a.a. - 190 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.