View larger
Human IL20 (Q9NYY1) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P4411
New product
IL20 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | IL20 |
| Gene Alias | IL-20|IL10D|MGC96907|ZCYTO10 |
| Gene Description | interleukin 20 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from 10 mM sodium citrate, 100 mM NaCl, pH 3.0 |
| Gene ID | 50604 |
More info
Human IL20 (Q9NYY1) recombinant protein expressed in Escherichia coli.