AB-P4326
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 100 ug |
Gene Name | Adipoq |
Gene Alias | 30kDa|APN|Acdc|Acrp30|GBP28|adipo|apM1 |
Gene Description | adiponectin, C1Q and collagen domain containing |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 1 mg/mL |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
Form | Liquid |
Antigen species Target species | Mouse |
Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
Storage Buffer | In 20 mM Tris-HCl buffer, 50 mM NaCl, pH 7.5 (5 mM DTT, 10% glycerol). |
Gene ID | 11450 |