View larger
Human ABO (NP_065202, 54 a.a. - 354 a.a. ) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P3941
New product
ABO (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | ABO |
| Gene Alias | A3GALNT|A3GALT1|GTB|NAGAT |
| Gene Description | ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQA |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS PAGE. |
| Storage Buffer | In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (2 mM DTT, 20% glycerol). |
| Gene ID | 28 |
More info
Human ABO (NP_065202, 54 a.a. - 354 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.