View larger
Human NT5M (NP_064586, 32 a.a. - 228 a.a. ) partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P3933
New product
NT5M (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | NT5M |
| Gene Alias | dNT-2|dNT2|mdN |
| Gene Description | 5',3'-nucleotidase, mitochondrial |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRPC |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol, 1 mM DTT). |
| Gene ID | 56953 |
More info
Human NT5M (NP_064586, 32 a.a. - 228 a.a. ) partial recombinant protein with His tag expressed in Escherichia coli.