View larger
Human IL1R1 (NP_003847.2, 19 a.a. - 328 a.a.) partial recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3829
New product
IL1R1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | IL1R1 |
| Gene Alias | CD121A|D2S1473|IL-1R-alpha|IL1R|IL1RA|P80 |
| Gene Description | interleukin 1 receptor, type I |
| Storage Conditions | Store at -20ºC. For long term storage store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQN |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 10% SDS-PAGE Result |
| Storage Buffer | In PBS (50% glycerol) |
| Gene ID | 3554 |
More info
Human IL1R1 (NP_003847.2, 19 a.a. - 328 a.a.) partial recombinant protein expressed in Escherichia coli.