View larger
Human DIABLO (NP_063940.1) full-length recombinant protein expressed in yeast.
AB-P3733
New product
DIABLO (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | DIABLO |
| Gene Alias | DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3 |
| Gene Description | diablo homolog (Drosophila) |
| Storage Conditions | Store at -20ºC. <br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol) |
| Gene ID | 56616 |
More info
Human DIABLO (NP_063940.1) full-length recombinant protein expressed in yeast.