CSF2 (Human) Recombinant Protein View larger

Human CSF2 (P04141, 1 a.a. - 144 a.a.) full-length recombinant protein. expressed in <i>Escherichia coli</i>.

AB-P3614

New product

CSF2 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 20 ug
Gene Name CSF2
Gene Alias GMCSF|MGC131935|MGC138897
Gene Description colony stimulating factor 2 (granulocyte-macrophage)
Storage Conditions Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.0
Gene ID 1437

More info

Human CSF2 (P04141, 1 a.a. - 144 a.a.) full-length recombinant protein. expressed in Escherichia coli.

Enviar uma mensagem

Human CSF2 (P04141, 1 a.a. - 144 a.a.) full-length recombinant protein. expressed in <i>Escherichia coli</i>.

Human CSF2 (P04141, 1 a.a. - 144 a.a.) full-length recombinant protein. expressed in <i>Escherichia coli</i>.