View larger
Human MSTN (O14793, 267 a.a. - 375 a.a.) partial recombinant protein. expressed in <i>Escherichia coli</i>.
AB-P3612
New product
MSTN (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | MSTN |
| Gene Alias | GDF8 |
| Gene Description | myostatin |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from Tris, pH 8.0 |
| Gene ID | 2660 |
More info
Human MSTN (O14793, 267 a.a. - 375 a.a.) partial recombinant protein. expressed in Escherichia coli.