MAPT (Human) Recombinant Protein View larger

Human MAPT (NP_001116539, 1 a.a. - 412 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P3577

New product

MAPT (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name MAPT
Gene Alias DDPAC|FLJ31424|FTDP-17|MAPTL|MGC138549|MSTD|MTBT1|MTBT2|PPND|TAU
Gene Description microtubule-associated protein tau
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTE
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol).
Gene ID 4137

More info

Human MAPT (NP_001116539, 1 a.a. - 412 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human MAPT (NP_001116539, 1 a.a. - 412 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human MAPT (NP_001116539, 1 a.a. - 412 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.