NDRG1 (Human) Recombinant Protein View larger

Human NDRG1 (NP_006087, 1 a.a. - 394 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

AB-P3493

New product

NDRG1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 100 ug
Gene Name NDRG1
Gene Alias CAP43|CMT4D|DRG1|GC4|HMSNL|NDR1|NMSL|PROXY1|RIT42|RTP|TARG1|TDD5
Gene Description N-myc downstream regulated 1
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPA
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol, 0.1 mM PMSF).
Gene ID 10397

More info

Human NDRG1 (NP_006087, 1 a.a. - 394 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Enviar uma mensagem

Human NDRG1 (NP_006087, 1 a.a. - 394 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.

Human NDRG1 (NP_006087, 1 a.a. - 394 a.a.) full-length recombinant protein with His tag expressed in <i>Escherichia coli</i>.