View larger
Human CUTA (NP_001014840, 33 a.a. - 179 a.a.) partial recombinant protein with His tag at C-terminal expressed in <i>Escherichia
AB-P3404
New product
CUTA (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | CUTA |
| Gene Alias | ACHAP|C6orf82|MGC111154 |
| Gene Description | cutA divalent cation tolerance homolog (E. coli) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPLEHHHHHH |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 10% glycerol). |
| Gene ID | 51596 |
More info
Human CUTA (NP_001014840, 33 a.a. - 179 a.a.) partial recombinant protein with His tag at C-terminal expressed in Escherichia coli.