View larger
Human PEA15 (NP_003759, 1 a.a. - 130 a.a.) full-length recombinant protein expressed in <i>Escherichia coli</i>.
AB-P3400
New product
PEA15 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PEA15 |
| Gene Alias | HMAT1|HUMMAT1H|MAT1|MAT1H|PEA-15|PED |
| Gene Description | phosphoprotein enriched in astrocytes 15 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 7.5 (1 mM DTT, 10% glycerol). |
| Gene ID | 8682 |
More info
Human PEA15 (NP_003759, 1 a.a. - 130 a.a.) full-length recombinant protein expressed in Escherichia coli.