ALDH16A1 (Human) Recombinant Protein (P01) View larger

Human ALDH16A1 full-length ORF ( NP_699160.1, 1 a.a. - 802 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00126133-P01

New product

ALDH16A1 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name ALDH16A1
Gene Alias MGC10204
Gene Description aldehyde dehydrogenase 16 family, member A1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MAATRAGPRAREIFTSLEYGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQDPITGENLASCLQAQAEDVAAAVEAARMAFKGWSAHPGVVRAQHLTRLAEVIQKHQRLLWTLESLVTGRAVREVRDGDVQLAQQLLHYHAIQASTQEEALAGWEPMGVIGLILPPTFSFLEMMWRICPALAVGCTVVALVPPASPAPLLLAQLAGELGPFPGILNVVSGPASLVPILASQPGIRKVAFCGAPEEG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 126133

More info

Human ALDH16A1 full-length ORF ( NP_699160.1, 1 a.a. - 802 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human ALDH16A1 full-length ORF ( NP_699160.1, 1 a.a. - 802 a.a.) recombinant protein with GST-tag at N-terminal.

Human ALDH16A1 full-length ORF ( NP_699160.1, 1 a.a. - 802 a.a.) recombinant protein with GST-tag at N-terminal.