SEMA4A (Human) Recombinant Protein (P01) View larger

Human SEMA4A full-length ORF ( NP_071762.2, 1 a.a. - 761 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00064218-P01

New product

SEMA4A (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name SEMA4A
Gene Alias CORD10|FLJ12287|RP35|SEMAB|SEMB
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFD
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 64218

More info

Human SEMA4A full-length ORF ( NP_071762.2, 1 a.a. - 761 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human SEMA4A full-length ORF ( NP_071762.2, 1 a.a. - 761 a.a.) recombinant protein with GST-tag at N-terminal.

Human SEMA4A full-length ORF ( NP_071762.2, 1 a.a. - 761 a.a.) recombinant protein with GST-tag at N-terminal.