View larger
Human BAZ2B full-length ORF ( AAH12576.1, 1 a.a. - 643 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00029994-P01
New product
BAZ2B (Human) Recombinant Protein (P01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 2 ug |
| Gene Name | BAZ2B |
| Gene Alias | DKFZp434H071|DKFZp762I0516|FLJ45644|WALp4 |
| Gene Description | bromodomain adjacent to zinc finger domain, 2B |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA,WB-Re,AP,Array |
| Immunogen Prot. Seq | MGQTKSTSSGGGNRKCNQEQSKNQPLDARVDKIKDKKPRKKAMESSSNSDSDSGTSSDTSSEGISSSDSDDLEEDEEEEDQSIEESEDDDSDSESEAQHKSNNQVLLHGISDPKADGQKATEKAQEKRIHQPLPLASESQTHSFQSQQKQPQVLSQQLPFIFQSSQAKEESVNKHTSVIQSTGLVSNVKPLSLVNQAKKETYMKLIVPSPDVLKAGNKNTSEESSSLTSELRSKREQYKQAFPSQLKKQESSKSL |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 29994 |
More info
Human BAZ2B full-length ORF ( AAH12576.1, 1 a.a. - 643 a.a.) recombinant protein with GST-tag at N-terminal.