HCFC2 (Human) Recombinant Protein (P02) View larger

Human HCFC2 full-length ORF ( AAH06558, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00029915-P02

New product

HCFC2 (Human) Recombinant Protein (P02)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name HCFC2
Gene Alias FLJ94012|HCF-2|HCF2
Gene Description host cell factor C2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPSGLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPVTKGVVPSPRESHTAVIYCKKDSGSPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGN
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 29915

More info

Human HCFC2 full-length ORF ( AAH06558, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human HCFC2 full-length ORF ( AAH06558, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.

Human HCFC2 full-length ORF ( AAH06558, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.