> >>>Human ABHD12 full-length ORF ( NP_056415.1, 1 a.a. - 404 a.a.) recombinant protein with GST-tag at N-terminal.
ABHD12 (Human) Recombinant Protein (P01) View larger

Human ABHD12 full-length ORF ( NP_056415.1, 1 a.a. - 404 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00026090-P01

New product

ABHD12 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name ABHD12
Gene Alias ABHD12A|BEM46L2|C20orf22|DKFZp434P106|dJ965G21.2
Gene Description abhydrolase domain containing 12
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKRALGRRKGVWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNL
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 26090

More info

Human ABHD12 full-length ORF ( NP_056415.1, 1 a.a. - 404 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human ABHD12 full-length ORF ( NP_056415.1, 1 a.a. - 404 a.a.) recombinant protein with GST-tag at N-terminal.

Human ABHD12 full-length ORF ( NP_056415.1, 1 a.a. - 404 a.a.) recombinant protein with GST-tag at N-terminal.