View larger
Purified ICOSLG (AAH64637.1 18 a.a. - 135 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in h
AB-H00023308-H02
New product
ICOSLG (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 2 ug |
| Gene Name | ICOSLG |
| Gene Alias | B7-H2|B7H2|B7RP-1|B7RP1|CD275|GL50|ICOS-L|ICOSL|KIAA0653|LICOS |
| Gene Description | inducible T-cell co-stimulator ligand |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Concentration | &ge |
| Application Key | WB,ELISA,SDS-PAGE,PI |
| Immunogen Prot. Seq | ADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVA |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE and Western Blot |
| Storage Buffer | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
| Host | Human HEK293T cells |
| Gene ID | 23308 |
More info
Purified ICOSLG (AAH64637.1 18 a.a. - 135 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.