AB-H00007398-P01
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 2 ug |
Gene Name | USP1 |
Gene Alias | UBP |
Gene Description | ubiquitin specific peptidase 1 |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Application Key | ELISA,WB-Re,AP,Array |
Immunogen Prot. Seq | MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQVVPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHPKEEMNGINSIEMDSMR |
Antigen species Target species | Human |
Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID | 7398 |