> >>>Human TAF6 full-length ORF ( NP_005632.1, 1 a.a. - 677 a.a.) recombinant protein with GST-tag at N-terminal.
TAF6 (Human) Recombinant Protein (P01) View larger

Human TAF6 full-length ORF ( NP_005632.1, 1 a.a. - 677 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00006878-P01

New product

TAF6 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 10 ug
Gene Name TAF6
Gene Alias DKFZp781E21155|MGC:8964|TAF2E|TAFII70|TAFII80|TAFII85
Gene Description TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQM
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 6878

More info

Human TAF6 full-length ORF ( NP_005632.1, 1 a.a. - 677 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human TAF6 full-length ORF ( NP_005632.1, 1 a.a. - 677 a.a.) recombinant protein with GST-tag at N-terminal.

Human TAF6 full-length ORF ( NP_005632.1, 1 a.a. - 677 a.a.) recombinant protein with GST-tag at N-terminal.