View larger
Human RARRES2 full-length ORF (NP_002880.1, 17 a.a. - 163 a.a.) recombinant protein with GST tag at N-terminal.
AB-H00005919-P02
New product
RARRES2 (Human) Recombinant Protein (P02)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | RARRES2 |
| Gene Alias | CHEMERIN|HP10433|TIG2 |
| Gene Description | retinoic acid receptor responder (tazarotene induced) 2 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA,WB-Re,AP,Array |
| Immunogen Prot. Seq | VGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 5919 |
More info
Human RARRES2 full-length ORF (NP_002880.1, 17 a.a. - 163 a.a.) recombinant protein with GST tag at N-terminal.