View larger
Human P2RY6 full-length ORF ( NP_004145.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.
AB-H00005031-P01
New product
P2RY6 (Human) Recombinant Protein (P01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 2 ug |
| Gene Name | P2RY6 |
| Gene Alias | MGC15335|P2Y6 |
| Gene Description | pyrimidinergic receptor P2Y, G-protein coupled, 6 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA,WB-Re,AP,Array |
| Immunogen Prot. Seq | MEWDNCTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPF |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 5031 |
More info
Human P2RY6 full-length ORF ( NP_004145.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.