View larger
Human CD151 full-length ORF (NP_004348.2) recombinant protein without tag.<br>This product is belong to Proteoliposome (PL).
AB-H00000977-G01
New product
CD151 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 ug |
| Gene Name | CD151 |
| Gene Alias | GP27|MER2|PETA-3|RAPH|SFA1|TSPAN24 |
| Gene Description | CD151 molecule (Raph blood group) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | AP |
| Immunogen Prot. Seq | MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY |
| Form | Liquid |
| Recomended Dilution | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Antigen species Target species | Human |
| Storage Buffer | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene ID | 977 |
More info
Human CD151 full-length ORF (NP_004348.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
This product is belong to Proteoliposome (PL).