View larger
Anti-RALGPS1 Antibody 100ul
AN-HPA014749-100ul
New product
Anti-RALGPS1
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 100ul |
| Gene Name | RALGPS1 |
| Gene Description | Ral GEF with PH domain and SH3 binding motif 1 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | HUMAN |
| Applications | IHC |
| Sequence | NMMCQLSVVESKSATFPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLES |
| Immunogen | NMMCQLSVVESKSATFPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLES |
| Product Group | Polyclonal Antibodies |
| Alternative Names | KIAA0351, RALGEF2, RALGPS1A |
| Category | Polyclonal |
| Host | RABBIT |
| UniProt ID | Q5JS13 |
| HTS Code | 3002150000 |
| Gene ID | 9649 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicativo | IHC |
| Conjugation | Unconjugated |
More info
Polyclonal Antibody against Human RALGPS1, Gene description: Ral GEF with PH domain and SH3 binding motif 1, Alternative Gene Names: KIAA0351, RALGEF2, RALGPS1A, Validated applications: IHC, Uniprot ID: Q5JS13, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF