Anti-BDP1 View larger

Anti-BDP1 Antibody 100ul

AN-HPA077984-100ul

New product

Anti-BDP1

More details

Registe-se for viewing this price!

Não há pontos de recompensa para este produto.


Data sheet

Size 100ul
Gene Name BDP1
Gene Description B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII
Immunogen YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII
Product Group Polyclonal Antibodies
Alternative Names HSA238520, KIAA1241, KIAA1689, TAF3B1, TFC5, TFIIIB150, TFIIIB90, TFNR
Category Polyclonal
Host RABBIT
UniProt ID A6H8Y1
HTS Code 3002150000
Gene ID 55814
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo ICC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human BDP1, Gene description: B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB, Alternative Gene Names: HSA238520, KIAA1241, KIAA1689, TAF3B1, TFC5, TFIIIB150, TFIIIB90, TFNR, Validated applications: ICC, Uniprot ID: A6H8Y1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image