Anti-IFRD1 View larger

Anti-IFRD1 Antibody 25ul

AN-HPA072413-25ul

New product

Anti-IFRD1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 25ul
Gene Name IFRD1
Gene Description interferon related developmental regulator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence ATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKS
Immunogen ATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKS
Product Group Polyclonal Antibodies
Alternative Names PC4, TIS7
Category Polyclonal
Host RABBIT
UniProt ID O00458
HTS Code 3002150000
Gene ID 3475
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo WB, IHC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human IFRD1, Gene description: interferon related developmental regulator 1, Alternative Gene Names: PC4, TIS7, Validated applications: IHC, WB, Uniprot ID: O00458, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image