View larger
Anti-SEMA3A Antibody 25ul
AN-HPA052235-25ul
New product
Anti-SEMA3A
Não há pontos de recompensa para este produto.
Data sheet
| Size | 25ul |
| Gene Name | SEMA3A |
| Gene Description | sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | ICC |
| Sequence | HGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHL |
| Immunogen | HGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHL |
| Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Product Group | Polyclonal Antibodies |
| Alternative Names | coll-1, Hsema-I, SEMA1, SEMAD, SemD |
| Category | Polyclonal |
| Isoelectric Point | IgG |
| Host | RABBIT |
| UniProt ID | Q14563 |
| HTS Code | 3002150000 |
| Gene ID | 10371 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicativo | ICC |
| Conjugation | Unconjugated |
More info
Polyclonal Antibody against Human SEMA3A, Gene description: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A, Alternative Gene Names: coll-1, Hsema-I, SEMA1, SEMAD, SemD, Validated applications: ICC, Uniprot ID: Q14563, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF